Recombinant Human ZNF790 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6PG37

Gene Name: ZNF790

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Lys401

End Site: Lys470

Coverage: 0.13

Isoelectric Point: 10

Core Sequence: KAYIWSSHLARHQRIHTGRKPYECKQCGKTFTWASYLAQHEKIHNERKSYECKECGKTFLHGSEFNRHQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 55%, Pig - 95%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 790

Protein name: zinc finger protein 790

Full length: 636 amino acids

Entry name: ZN790_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3591-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3591-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 388536