Recombinant Human ZNF792 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q3KQV3

Gene Name: ZNF792

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 34%

Start Site: Phe171

End Site: Arg280

Coverage: 0.19

Isoelectric Point: 7

Core Sequence: FSANLPRKQVQQNVHNPIRTEEGQASPVKTCRDHTSDQLSTCREGGKDFVATAGFLQCEVTPSDGEPHEATEGVVDFHIALRHNKCCESGDAFNNKSTLVQHQRIHSRER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 34%, Rat - 34%, Pig - 47%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Zinc finger protein 792

Protein name: zinc finger protein 792

Full length: 632 amino acids

Entry name: ZN792_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3595-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3595-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 126375