Recombinant Human ZNF80 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P51504

Gene Name: ZNF80

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Gly11

End Site: Gln80

Coverage: 0.32

Isoelectric Point: 7.5

Core Sequence: GDGLHSQVLQEQVSTGDNLHECDSQGPSKDTLVREGKTYKCKECGSVFNKNSLLVRHQQIHTGVKPYECQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Rat - 45%, Pig - 60%, Cynomolgus monkey - 63%

Alternative gene names: /

Alternative protein names: Zinc finger protein 80; ZNFpT17

Protein name: zinc finger protein 80

Full length: 273 amino acids

Entry name: ZNF80_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3507-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3507-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7634