Recombinant Human ZNF805 Protein

Recombinant Human ZNF805 Protein
SKU
ASBPP-3392-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5CZA5

Gene Name: ZNF805

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Phe131

End Site: Phe240

Coverage: 0.19

Isoelectric Point: 7

Core Sequence: FSEMQGERLRPGLDSQKEKLPGKMSPKHDGLGTADSVCSRIIQDRVSLGDDVHDCDSHGSGKNPVIQEEENIFKCNECEKVFNKKRLLARHERIHSGVKPYECTECGKTF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 36%, Pig - 71%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 805

Protein name: zinc finger protein 805

Full length: 627 amino acids

Entry name: ZN805_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3392-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3392-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 390980
Product information (PDF)
×
MSDS (PDF)
×