Recombinant Human ZNF808 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N4W9

Gene Name: ZNF808

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu121

End Site: Ser230

Coverage: 0.12

Isoelectric Point: 8

Core Sequence: ERNGHEAPTTKIKKLTGSTDQHDHRHAGNKPIKDQLGSSFYSHLPELHIFQIKGEIANQLEKSTSDASSVSTSQRISCRPQIHISNNYGNNPLNSSLLPQKQEVHMREKS

Homologies: Highest protein sequence identity to the following orthologs: Pig - 36%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 808

Protein name: zinc finger protein 808

Full length: 903 amino acids

Entry name: ZN808_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3532-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3532-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 388558