Recombinant Human ZNF829 Protein

Recombinant Human ZNF829 Protein
SKU
ASBPP-3460-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q3KNS6

Gene Name: ZNF829

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Arg21

End Site: Lys120

Coverage: 0.24

Isoelectric Point: 4.5

Core Sequence: RMHDELLQAVSKGPVMFRDVSIDFSQEEWECLDADQMNLYKEVMLENFSNLVSVGLSNSKPAVISLLEQGKEPWMVDRELTRGLCSDLESMCETKILSLK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 53%, Pig - 88%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 829

Protein name: zinc finger protein 829

Full length: 432 amino acids

Entry name: ZN829_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3460-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3460-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 374899
Product information (PDF)
×
MSDS (PDF)
×