Recombinant Human ZNF835 Protein

Recombinant Human ZNF835 Protein
SKU
ASBPP-3515-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2P0

Gene Name: ZNF835

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Gly11

End Site: Arg130

Coverage: 0.25

Isoelectric Point: 6.5

Core Sequence: GAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFSRIPRTISSPAATQASVPDDSSSRRCSAPGESPKERHPDSRQRERGGGPKKPWKCGDCGKAFSYCSAFILHQR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 60%, Pig - 46%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 835

Protein name: zinc finger protein 835

Full length: 537 amino acids

Entry name: ZN835_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3515-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3515-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 90485
Product information (PDF)
×
MSDS (PDF)
×