Recombinant Human ZNF84 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P51523

Gene Name: ZNF84

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Glu491

End Site: Pro570

Coverage: 0.13

Isoelectric Point: 7.5

Core Sequence: ECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 71%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 84; Zinc finger protein HPF2

Protein name: zinc finger protein 84

Full length: 738 amino acids

Entry name: ZNF84_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3404-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3404-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 7637