Note: Dry Ice fees will be extra-charged
Uniprot: A6NDX5
Gene Name: ZNF840P
Expression System: Escherichia coli
Molecular Weight: 12.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 54%
Start Site: Arg481
End Site: Ile570
Coverage: 0.13
Isoelectric Point: 11
Core Sequence: RFNNNSNLNKHKKIHTGEKHFVCNQCGKAFSLNSKLSRHQRTHNKKENSSKSVSNLNKHQKTHAGEKPFPCNECKKAFAQRMDLARHQQI
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 54%, Pig - 53%, Cynomolgus monkey - 94%
Alternative gene names: C20orf157; ZNF840
Alternative protein names: Putative zinc finger protein 840; Zinc finger protein 840 pseudogene
Protein name: zinc finger protein 840, pseudogene
Full length: 716 amino acids
Entry name: ZN840_HUMAN
Product panel: DNA binding & Chromatin
English
Deutsch
