Recombinant Human ZNF840P Protein

Recombinant Human ZNF840P Protein
SKU
ASBPP-3611-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A6NDX5

Gene Name: ZNF840P

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Arg481

End Site: Ile570

Coverage: 0.13

Isoelectric Point: 11

Core Sequence: RFNNNSNLNKHKKIHTGEKHFVCNQCGKAFSLNSKLSRHQRTHNKKENSSKSVSNLNKHQKTHAGEKPFPCNECKKAFAQRMDLARHQQI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 54%, Pig - 53%, Cynomolgus monkey - 94%

Alternative gene names: C20orf157; ZNF840

Alternative protein names: Putative zinc finger protein 840; Zinc finger protein 840 pseudogene

Protein name: zinc finger protein 840, pseudogene

Full length: 716 amino acids

Entry name: ZN840_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3611-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3611-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 100533646
Product information (PDF)
×
MSDS (PDF)
×