Recombinant Human ZNF846 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q147U1

Gene Name: ZNF846

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Glu11

End Site: Gly120

Coverage: 0.22

Isoelectric Point: 5

Core Sequence: EDVAVDFTQEEWTLLDQAQRDLYRDVMLENYKNLIILAGSELFKRSLMSGLEQMEELRTGVTGVLQELDLQLKTKGSPLLQDISAERSPNGVQLERSNTAEKLYDSNHSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 48%, Pig - 46%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 846

Protein name: zinc finger protein 846

Full length: 533 amino acids

Entry name: ZN846_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3464-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3464-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 162993