Recombinant Human ZNF850 Protein

Recombinant Human ZNF850 Protein
SKU
ASBPP-3385-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A8MQ14

Gene Name: ZNF850

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Tyr421

End Site: Leu520

Coverage: 0.09

Isoelectric Point: 9

Core Sequence: YDCKECGKSFTAGSTLIQHQRIHTGEKPYDCKECGKSFASGSALLQHQRIHTGEKPYCCKECGKSFTFRSTRNRHQRIHTGEKPYNCKECGKSFASGSAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 65%, Pig - 75%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 850

Protein name: zinc finger protein 850

Full length: 1090 amino acids

Entry name: ZN850_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3385-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3385-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 342892
Product information (PDF)
×
MSDS (PDF)
×