Recombinant Human ZNF852 Protein

Recombinant Human ZNF852 Protein
SKU
ASBPP-3437-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZMS4

Gene Name: ZNF852

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Cys91

End Site: Ile180

Coverage: 0.18

Isoelectric Point: 4.5

Core Sequence: CEDTFKELEGQPSNEEGSRLESDFLEIIDEDKKKSTKDRYEEYKEVEEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFYWSSHLIGHRRI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 57%, Pig - 68%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Zinc finger protein 852

Protein name: zinc finger protein 852

Full length: 543 amino acids

Entry name: ZN852_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3437-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3437-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 285346
Product information (PDF)
×
MSDS (PDF)
×