Recombinant Human ZNF875 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P10072

Gene Name: ZNF875

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Arg181

End Site: Leu260

Coverage: 0.14

Isoelectric Point: 5

Core Sequence: RLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNL

Homologies: Highest protein sequence identity to the following orthologs: Pig - 40%, Cynomolgus monkey - 91%

Alternative gene names: HKR1

Alternative protein names: Zinc finger protein 875; Krueppel-related zinc finger protein 1; Protein HKR1

Protein name: zinc finger protein 875

Full length: 659 amino acids

Entry name: ZN875_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10381-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10381-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 284459