Recombinant Human ZNF883 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P0CG24

Gene Name: ZNF883

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Thr51

End Site: Thr120

Coverage: 0.21

Isoelectric Point: 7.5

Core Sequence: TRNSNLVQHQRIHTGEKPYECNECGKAFSQSTNLIQHQRVHTGEKPYECNECEKTFSHRSSLRNHERIHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 75%, Pig - 91%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 883

Protein name: zinc finger protein 883

Full length: 379 amino acids

Entry name: ZN883_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3547-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3547-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 169834