Recombinant Human ZNF888 Protein

Recombinant Human ZNF888 Protein
SKU
ASBPP-3551-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0CJ79

Gene Name: ZNF888

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Arg11

End Site: Ala170

Coverage: 0.23

Isoelectric Point: 6

Core Sequence: RDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMEFSSIGKGNTEVIHTGTLQRLASHHIGECCFQEIEKDIHDFVFQWQEDETNGHEAPMTEIKELTGSTDQYDQRHAGNKPIKYQLGSSFHSHLPELHIFQPEGKIGNQLEKSINNA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 67%, Pig - 49%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Zinc finger protein 888

Protein name: zinc finger protein 888

Full length: 718 amino acids

Entry name: ZN888_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3551-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3551-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 388559
Product information (PDF)
×
MSDS (PDF)
×