Recombinant Human ZNF891 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A8MT65

Gene Name: ZNF891

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Thr301

End Site: Ser390

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: TLCHQSSLKKQGQTHTEKKHECNQCGKAFKRISNLTLYKKSHMGEKQYECKECGKVFNDSSTLRRHVRTHTGEKPYECNQCGKAFSQKTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 57%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 891

Protein name: zinc finger protein 891

Full length: 544 amino acids

Entry name: ZN891_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3620-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3620-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 101060200