Recombinant Human ZNF891 Protein

Recombinant Human ZNF891 Protein
SKU
ASBPP-3620-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A8MT65

Gene Name: ZNF891

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Thr301

End Site: Ser390

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: TLCHQSSLKKQGQTHTEKKHECNQCGKAFKRISNLTLYKKSHMGEKQYECKECGKVFNDSSTLRRHVRTHTGEKPYECNQCGKAFSQKTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 57%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 891

Protein name: zinc finger protein 891

Full length: 544 amino acids

Entry name: ZN891_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3620-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3620-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 101060200
Product information (PDF)
×
MSDS (PDF)
×