Recombinant Human ZNF90 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q03938

Gene Name: ZNF90

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: His391

End Site: Thr470

Coverage: 0.14

Isoelectric Point: 9

Core Sequence: HSEKKPYKCEECGKAFKRSSTLTIHKISHTEEKPYKCQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 57%, Pig - 63%, Cynomolgus monkey - 82%

Alternative gene names: /

Alternative protein names: Zinc finger protein 90; Zinc finger protein HTF9

Protein name: zinc finger protein 90

Full length: 601 amino acids

Entry name: ZNF90_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3463-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3463-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7643