Recombinant Human ZNF91 Protein

Recombinant Human ZNF91 Protein
SKU
ASBPP-10396-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q05481

Gene Name: ZNF91

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Glu801

End Site: Lys880

Coverage: 0.07

Isoelectric Point: 9.5

Core Sequence: EECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 69%, Pig - 71%, Cynomolgus monkey - 82%

Alternative gene names: /

Alternative protein names: Zinc finger protein 91; Zinc finger protein HPF7; Zinc finger protein HTF10

Protein name: zinc finger protein 91

Full length: 1191 amino acids

Entry name: ZNF91_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10396-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10396-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7644
Product information (PDF)
×
MSDS (PDF)
×