Recombinant Human ZNF91 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q05481

Gene Name: ZNF91

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Glu801

End Site: Lys880

Coverage: 0.07

Isoelectric Point: 9.5

Core Sequence: EECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 69%, Pig - 71%, Cynomolgus monkey - 82%

Alternative gene names: /

Alternative protein names: Zinc finger protein 91; Zinc finger protein HPF7; Zinc finger protein HTF10

Protein name: zinc finger protein 91

Full length: 1191 amino acids

Entry name: ZNF91_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10396-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10396-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7644