Recombinant Human ZNHIT1 Protein

Recombinant Human ZNHIT1 Protein
SKU
ASBPP-3555-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43257

Gene Name: ZNHIT1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gln41

End Site: Ser110

Coverage: 0.53

Isoelectric Point: 8.5

Core Sequence: QDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: CGBP1; ZNFN4A1

Alternative protein names: Zinc finger HIT domain-containing protein 1; Cyclin-G1-binding protein 1; Zinc finger protein subfamily 4A member 1; p18 Hamlet

Protein name: zinc finger HIT-type containing 1

Full length: 154 amino acids

Entry name: ZNHI1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3555-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3555-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10467
Product information (PDF)
×
MSDS (PDF)
×