Recombinant Human ZSCAN1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NBB4

Gene Name: ZSCAN1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu141

End Site: His310

Coverage: 0.44

Isoelectric Point: 7

Core Sequence: EEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAGPSSDLRAEGTVISSPKGPSAQRISPRRRNRNTDQSGRHQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEH

Homologies: Highest protein sequence identity to the following orthologs: Pig - 34%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Zinc finger and SCAN domain-containing protein 1

Protein name: zinc finger and SCAN domain containing 1

Full length: 408 amino acids

Entry name: ZSCA1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3487-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3487-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 284312