Recombinant Human ZSCAN1 Protein

Recombinant Human ZSCAN1 Protein
SKU
ASBPP-3487-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NBB4

Gene Name: ZSCAN1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu141

End Site: His310

Coverage: 0.44

Isoelectric Point: 7

Core Sequence: EEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAGPSSDLRAEGTVISSPKGPSAQRISPRRRNRNTDQSGRHQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEH

Homologies: Highest protein sequence identity to the following orthologs: Pig - 34%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Zinc finger and SCAN domain-containing protein 1

Protein name: zinc finger and SCAN domain containing 1

Full length: 408 amino acids

Entry name: ZSCA1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3487-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3487-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 284312
Product information (PDF)
×
MSDS (PDF)
×