Recombinant Human ZSCAN32 Protein

Recombinant Human ZSCAN32 Protein
SKU
ASBPP-3390-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NX65

Gene Name: ZSCAN32

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ile361

End Site: Thr460

Coverage: 0.15

Isoelectric Point: 5.5

Core Sequence: IEAGELNHQNGEPTEVEDGTVDGADRDEKDFRNPGQEVRKLDLPVLFPNRLGFEFKNEIKKENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPT

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 95%

Alternative gene names: ZNF434

Alternative protein names: Zinc finger and SCAN domain-containing protein 32; Human cervical cancer suppressor gene 5 protein; HCCS-5; Zinc finger protein 434

Protein name: zinc finger and SCAN domain containing 32

Full length: 697 amino acids

Entry name: ZSC32_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3390-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3390-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 54925
Product information (PDF)
×
MSDS (PDF)
×