Recombinant Human ZSWIM7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q19AV6

Gene Name: ZSWIM7

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Met1

End Site: Ala140

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGSSATQALDLVDRQSITLISSPSGRRVYQVLGSSSKTYTCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Pig - 87%, Cynomolgus monkey - 99%

Alternative gene names: SWS1

Alternative protein names: Zinc finger SWIM domain-containing protein 7; SWIM domain-containing and Srs2-interacting protein 1 homolog; SWIM-type zinc finger domain-containing protein 7

Protein name: zinc finger SWIM-type containing 7

Full length: 140 amino acids

Entry name: ZSWM7_HUMAN

• SKU: ASBPP-3520-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3520-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 125150