Research Areas: Cardiovascular
Uniprot: P31532
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 19.2 kDa
Gene Names: Saa4
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 19-130aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: DGWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF
Endotoxin: Not test.
Relevance: Major acute phase reactant.
Reference: "Structure of the mouse serum amyloid A 5 (Saa5) gene: relationship to other members of the serum amyloid A family."Butler A., Whitehead A.S.Scand. J. Immunol. 45:160-165(1997)
English
Deutsch
