Research Areas: Cancer
Uniprot: Q62226
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl
Form: Lyophilized powder
Tag Info: Tag-Free
Purity: >95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 19.8 kDa
Gene Names: Shh,Hhg1
Organism: Mus musculus (Mouse)
Source: E.Coli
Expression Region: 26-198aa
Protein Length: Partial
Target Protein Sequence: GPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Biological_Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine C3H10T1/2 cells is 0.5 - 1.0 μg/ml.
Relevance: Intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction. Activates the transcription of target genes by interacting with its receptor PTCH1 to prevent normal inhibition by PTCH1 on the constitutive signaling activity of SMO. {ECO:0000269/PubMed:14687547, ECO:0000269/PubMed:7736596}.
Function: Sonic hedgehog protein
English
Deutsch
