Research Areas: Neuroscience
Uniprot: Q9WUK5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 10xHis-HSA-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 80.7 kDa
Gene Names: Inhbc
Organism: Rattus norvegicus (Rat)
Source: Mammalian cell
Expression Region: 237-351aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Endotoxin: Not test.
Relevance: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
English
Deutsch
