Anti-LRFN4

leucine rich repeat and fibronectin type III domain containing 4, Polyclonal, IgG, Rabbit

GeneName: LRFN4

Concentration: 0,05

Sequence: GEGTLESEPAVQVTEVTATSGLVSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLC

InterspeciesReactivity: ENSMUSG00000045045: 99%, ENSRNOG00000019356: 99%

Entrez Gene ID: 78999

Uniprot ID: Q6PJG9

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal LRFN4 Antibody against Human leucine rich repeat and fibronectin type III domain containing 4. Validated for Western Blot

• SKU: ATLHPA062695-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA062695-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 78999
• Host: Rabbit
• Conjugate: Unconjugated