Anti-OGFOD3

2-oxoglutarate and iron dependent oxygenase domain containing 3, Polyclonal, IgG, Rabbit

GeneName: OGFOD3

Concentration: 0,05

Sequence: SFDYTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFFTSGSENLHRVEKVHWGTRYAITIAFSCNPDHGIE

InterspeciesReactivity: ENSMUSG00000025169: 94%, ENSRNOG00000036668: 94%

Entrez Gene ID: 79701

Uniprot ID: Q6PK18

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal OGFOD3 Antibody against Human 2-oxoglutarate and iron dependent oxygenase domain containing 3. Validated for Western Blot

• SKU: ATLHPA075059-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA075059-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 79701
• Host: Rabbit
• Conjugate: Unconjugated