Anti-RTEL1

regulator of telomere elongation helicase 1, Polyclonal, IgG, Rabbit

GeneName: RTEL1

Concentration: 0,1

Sequence: PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG

InterspeciesReactivity: ENSMUSG00000038685: 53%, ENSRNOG00000027513: 60%

Entrez Gene ID: 51750

Uniprot ID: Q9NZ71

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal RTEL1 Antibody against Human regulator of telomere elongation helicase 1. Validated for Western Blot

• SKU: ATLHPA078376-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA078376-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 51750
• Host: Rabbit
• Conjugate: Unconjugated