Anti-ZHX1

zinc fingers and homeoboxes 1, Polyclonal, IgG, Rabbit

GeneName: ZHX1

Concentration: 0,05

Sequence: KEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESG

InterspeciesReactivity: ENSMUSG00000022361: 84%, ENSRNOG00000006412: 84%

Entrez Gene ID: 11244

Uniprot ID: Q9UKY1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ZHX1 Antibody against Human zinc fingers and homeoboxes 1. Validated for Western Blot

• SKU: ATLHPA064462-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA064462-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 11244
• Host: Rabbit
• Conjugate: Unconjugated