PrEST Antigen BDP1

B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
SKU
ATLAPREST95497-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII

GeneName: BDP1

Ensembl Gene ID: ENSG00000145734

UniProt ID: A6H8Y1

Entrez Gene ID: 55814

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000017864: 80%, ENSMUSG00000049658: 78%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST95497-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST95497-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 55814
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download