PrEST Antigen C10orf90

chromosome 10 open reading frame 90
SKU
ATLAPREST95295-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: LKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGV

GeneName: C10orf90

Ensembl Gene ID: ENSG00000154493

UniProt ID: Q96M02

Entrez Gene ID: 118611

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000030994: 65%, ENSRNOG00000027542: 59%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST95295-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST95295-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 118611
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download