PrEST Antigen CITED2

Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2
SKU
ATLAPrEST95646-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: AFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKH

GeneName: CITED2

Ensembl Gene ID: ENSG00000164442

UniProt ID: Q99967

Entrez Gene ID: 10370

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000056940: 100%, ENSMUSG00000039910: 99%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPrEST95646-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST95646-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 10370
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download