PrEST Antigen PINX1

PIN2/TERF1 interacting telomerase inhibitor 1

Sequence: ENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQP

GeneName: PINX1

Ensembl Gene ID: ENSG00000254093

UniProt ID: Q96BK5

Entrez Gene ID: 54984

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000021958: 70%, ENSRNOG00000012012: 63%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPREST94565-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST94565-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 54984
• Conjugate: Unconjugated