PrEST Antigen SLC6A17

solute carrier family 6 (neutral amino acid transporter), member 17

Sequence: RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL

GeneName: SLC6A17

Ensembl Gene ID: ENSG00000197106

UniProt ID: Q9H1V8

Entrez Gene ID: 388662

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000027894: 97%, ENSRNOG00000050090: 97%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPREST71190
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APREST71190-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 388662
• Conjugate: Unconjugated