PrEST Antigen VAT1L

vesicle amine transport 1 like
SKU
ATLAPREST94816-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: KHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQVEKVNPIKLY

GeneName: VAT1L

Ensembl Gene ID: ENSG00000171724

UniProt ID: Q9HCJ6

Entrez Gene ID: 57687

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000046844: 100%, ENSRNOG00000011989: 100%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST94816-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST94816-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 57687
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download