PrEST Antigen WDR26

WD repeat domain 26

Sequence: KLLKTLEGHAYGVSYIAWSPDDNYLVACGPDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG

GeneName: WDR26

Ensembl Gene ID: ENSG00000162923

UniProt ID: Q9H7D7

Entrez Gene ID: 80232

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000003723: 99%, ENSMUSG00000038733: 99%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPREST94600-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST94600-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 80232
• Conjugate: Unconjugated