PrEST Antigen ZNF175

zinc finger protein 175
SKU
ATLAPrEST95863-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: LYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRD

GeneName: ZNF175

Ensembl Gene ID: ENSG00000105497

UniProt ID: Q9Y473

Entrez Gene ID: 7728

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000012640: 51%, ENSRNOG00000023233: 38%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPrEST95863-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST95863-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 7728
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download