PrEST Antigen ZSCAN10

zinc finger and SCAN domain containing 10
SKU
ATLAPREST95425-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Sequence: PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD

GeneName: ZSCAN10

Ensembl Gene ID: ENSG00000130182

UniProt ID: Q96SZ4

Entrez Gene ID: 84891

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000021782: 61%, ENSMUSG00000023902: 67%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPREST95425-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST95425-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 84891
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download