Anti-ADAMTS4

ADAM metallopeptidase with thrombospondin type 1 motif 4, Polyclonal, IgG, Rabbit

GeneName: ADAMTS4

Concentration: 0,05

Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN

InterspeciesReactivity: ENSMUSG00000006403: 95%, ENSRNOG00000003538: 92%

Entrez Gene ID: 9507

Uniprot ID: O75173

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ADAMTS4 Antibody against Human ADAM metallopeptidase with thrombospondin type 1 motif 4. Validated for Western Blot

• SKU: ATLHPA070099-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA070099-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 9507
• Host: Rabbit
• Conjugate: Unconjugated