Anti-BANK1

B-cell scaffold protein with ankyrin repeats 1, Polyclonal, IgG, Rabbit

GeneName: BANK1

Concentration: 0,2

Sequence: IGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLCQNSIEELDGVL

InterspeciesReactivity: ENSMUSG00000037922: 68%, ENSRNOG00000032247: 60%

Entrez Gene ID: 55024

Uniprot ID: Q8NDB2

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal BANK1 Antibody against Human B cell scaffold protein with ankyrin repeats 1. Validated for Western Blot

• SKU: ATLHPA058190-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA058190-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 55024
• Host: Rabbit
• Conjugate: Unconjugated