Anti-FBXW9

F-box and WD repeat domain containing 9, Polyclonal, IgG, Rabbit

GeneName: FBXW9

Concentration: 0,05

Sequence: MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVSEPG

InterspeciesReactivity: ENSMUSG00000008167: 53%, ENSRNOG00000004212: 56%

Entrez Gene ID: 84261

Uniprot ID: Q5XUX1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal FBXW9 Antibody against Human F-box and WD repeat domain containing 9. Validated for Western Blot

• SKU: ATLHPA051030-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA051030-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 84261
• Host: Rabbit
• Conjugate: Unconjugated