Anti-GTSE1

G2 and S-phase expressed 1, Polyclonal, IgG, Rabbit

GeneName: GTSE1

Concentration: 0,1

Sequence: IPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSE

InterspeciesReactivity: ENSMUSG00000022385: 56%, ENSRNOG00000016148: 57%

Entrez Gene ID: 51512

Uniprot ID: Q9NYZ3

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal GTSE1 Antibody against Human G2 and S-phase expressed 1. Validated for Western Blot

• SKU: ATLHPA049873-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA049873-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 51512
• Host: Rabbit
• Conjugate: Unconjugated