Anti-RASEF

RAS and EF-hand domain containing, Polyclonal, IgG, Rabbit

GeneName: RASEF

Concentration: 0,1

Sequence: GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL

InterspeciesReactivity: ENSMUSG00000043003: 75%, ENSRNOG00000024190: 71%

Entrez Gene ID: 158158

Uniprot ID: Q8IZ41

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal RASEF Antibody against Human RAS and EF-hand domain containing. Validated for Western Blot

• SKU: ATLHPA051606-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA051606-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 158158
• Host: Rabbit
• Conjugate: Unconjugated