Anti-SCUBE3

signal peptide, CUB domain, EGF-like 3, Polyclonal, IgG, Rabbit

GeneName: SCUBE3

Concentration: 0,3

Sequence: LRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAHKPGLVAGERAEPMESCRPGQHRAGTKCVSCPQGTYYHGQTEQCVPCP

InterspeciesReactivity: ENSMUSG00000038677: 94%, ENSRNOG00000000500: 94%

Entrez Gene ID: 222663

Uniprot ID: Q8IX30

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SCUBE3 Antibody against Human signal peptide, CUB domain and EGF like domain containing 3. Validated for Western Blot

• SKU: ATLHPA049734-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA049734-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 222663
• Host: Rabbit
• Conjugate: Unconjugated