Anti-VPS39

VPS39 subunit of HOPS complex, Polyclonal, IgG, Rabbit

GeneName: VPS39

Concentration: 0,1

Sequence: AWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIE

InterspeciesReactivity: ENSMUSG00000027291: 98%, ENSRNOG00000008316: 97%

Entrez Gene ID: 23339

Uniprot ID: Q96JC1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal VPS39 Antibody against Human VPS39 subunit of HOPS complex. Validated for Western Blot

• SKU: ATLHPA048192-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA048192-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 23339
• Host: Rabbit
• Conjugate: Unconjugated