TFEB Antibody - middle region : FITC

TFEB Antibody - middle region : FITC
SKU
AVIARP58116_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor EB

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP58116_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58116_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7942
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×